Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frg1 Peptide - middle region

Frg1 Peptide - middle region

Product Specifications

UniProt

P97376

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Frg1 Rabbit Polyclonal Antibody (orb330778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038550

Preservative

Lyophilized powder

AA Sequence

GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Anti-Complement 1q Antibody Anti-Complement 1q Antibody (Anti-C1q) ELISA Kit
EIA05270Bo 1 Kit

Bovine Anti-Complement 1q Antibody Anti-Complement 1q Antibody (Anti-C1q) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal CD48/SLAMF2 Antibody (CD48/8360R) [Alexa Fluor 405]
NBP3-21026AF405 0.1 mL

Rabbit Monoclonal CD48/SLAMF2 Antibody (CD48/8360R) [Alexa Fluor 405]

Sign In for Pricing
View Details
Mouse MARCHF2 shRNA Plasmid
abx981352-01 150 µg

Mouse MARCHF2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse MARCHF2 shRNA Plasmid
abx981352-02 300 µg

Mouse MARCHF2 shRNA Plasmid

Sign In for Pricing
View Details
Tofacitinib Impurity 248
RM-T060576-01 10 mg

Tofacitinib Impurity 248

Sign In for Pricing
View Details
Tofacitinib Impurity 248
RM-T060576-02 25 mg

Tofacitinib Impurity 248

Sign In for Pricing
View Details