Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frg1 Peptide - middle region

Frg1 Peptide - middle region

Product Specifications

UniProt

P97376

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Frg1 Rabbit Polyclonal Antibody (orb330778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038550

Preservative

Lyophilized powder

AA Sequence

GINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAGDIEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R) -3-Amino-3- (2-fluoro-phenyl) -propionic acid
463786-01 100 mg

(R) -3-Amino-3- (2-fluoro-phenyl) -propionic acid

Sign In for Pricing
View Details
(R) -3-Amino-3- (2-fluoro-phenyl) -propionic acid
463786-02 250 mg

(R) -3-Amino-3- (2-fluoro-phenyl) -propionic acid

Sign In for Pricing
View Details
EIF2D Knockout HEK293T Polyclonal Cells
ARG40995 1 Million

EIF2D Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Anti-Platelet Derived Growth Factor Receptor Beta (PDGFRB) Polyclonal antibody
FY-AB37711-01 1 mL

Anti-Platelet Derived Growth Factor Receptor Beta (PDGFRB) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Platelet Derived Growth Factor Receptor Beta (PDGFRB) Polyclonal antibody
FY-AB37711-02 100 µL

Anti-Platelet Derived Growth Factor Receptor Beta (PDGFRB) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Platelet Derived Growth Factor Receptor Beta (PDGFRB) Polyclonal antibody
FY-AB37711-03 200 µL

Anti-Platelet Derived Growth Factor Receptor Beta (PDGFRB) Polyclonal antibody

Sign In for Pricing
View Details