Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSTL5 Peptide - middle region

FSTL5 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp566D234, KIAA1263

UniProt

Q8N475

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSTL5 Rabbit Polyclonal Antibody (orb583534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121900

Preservative

Lyophilized powder

AA Sequence

NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TEP1 Antibody [Alexa Fluor 750]
NBP3-05903AF750 0.1 mL

Rabbit Polyclonal TEP1 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
TNNI3 Peptide (AAP41391)
AAP41391-100UG 100 µg

TNNI3 Peptide (AAP41391)

Sign In for Pricing
View Details
AU022252 Double Nickase Plasmid (m)
sc-432969-NIC 20 µg

AU022252 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CCKAR-RFP (Neo) Lentivirus
LVP1038-N 1x 10^7 IFU/mL - 200 μL

CCKAR-RFP (Neo) Lentivirus

Sign In for Pricing
View Details
APRG1, ID (APRG1, C3orf35, AP20 region protein 1) (Azide free) (HRP) discontinued
032002-HRP 200 µL

APRG1, ID (APRG1, C3orf35, AP20 region protein 1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
PTPRF Adenovirus (Mouse)
38174054 1.0 mL

PTPRF Adenovirus (Mouse)

Sign In for Pricing
View Details