Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FSTL5 Peptide - middle region

FSTL5 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp566D234, KIAA1263

UniProt

Q8N475

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FSTL5 Rabbit Polyclonal Antibody (orb583534) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001121900

Preservative

Lyophilized powder

AA Sequence

NRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWVGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Normal Horse Serum Ster Filt
GWB-EE3065 100 mL

Normal Horse Serum Ster Filt

Sign In for Pricing
View Details
Atg12 (C-6) Alexa Fluor® 647
sc-271688 AF647 200 µg/mL

Atg12 (C-6) Alexa Fluor® 647

Sign In for Pricing
View Details
Recombinant Human CD90/Thy1 Protein
NBP2-52389-0.02mg 0.02 mg

Recombinant Human CD90/Thy1 Protein

Sign In for Pricing
View Details
Agpat1 Polyclonal Antibody
CAC10620-01 50 µL

Agpat1 Polyclonal Antibody

Sign In for Pricing
View Details
Agpat1 Polyclonal Antibody
CAC10620-02 100 µL

Agpat1 Polyclonal Antibody

Sign In for Pricing
View Details
PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405) discontinued
039913-ML405 100 µL

PGAP2, CT (PGAP2, FRAG1, Post-GPI attachment to proteins factor 2, FGF receptor-activating protein 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details