Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FYN Peptide - middle region

FYN Peptide - middle region

Product Specifications

Product Name Alternative

MGC45350, SLK, SYN, p59-FYN

UniProt

P06241

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FYN Rabbit Polyclonal Antibody (orb330813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002028

Preservative

Lyophilized powder

AA Sequence

CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G6PD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0827007 1.0 µg DNA

G6PD sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Kcnip4 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7194902 1.0 µg DNA

Kcnip4 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Canine AIG1 ELISA Kit
ECA0501 96 Tests

Canine AIG1 ELISA Kit

Sign In for Pricing
View Details
PNPO Mouse Monoclonal Antibody [Clone ID: OTI3B3]
CF503249 100 µg

PNPO Mouse Monoclonal Antibody [Clone ID: OTI3B3]

Sign In for Pricing
View Details
VAMP3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
49417156 3x 1.0 µg DNA

VAMP3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human Cytochrome P450 1A1 (CYP1A1) ELISA Kit
DLR-CYP1A1-Hu-96T 96 Tests

Human Cytochrome P450 1A1 (CYP1A1) ELISA Kit

Sign In for Pricing
View Details