Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FYN Peptide - middle region

FYN Peptide - middle region

Product Specifications

Product Name Alternative

MGC45350, SLK, SYN, p59-FYN

UniProt

P06241

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FYN Rabbit Polyclonal Antibody (orb330813) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002028

Preservative

Lyophilized powder

AA Sequence

CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd209b Recombinant Protein (Mouse)
RP122426 100 µg

Cd209b Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Vandetanib Impurity 12
RM-V042012-01 10 mg

Vandetanib Impurity 12

Sign In for Pricing
View Details
Vandetanib Impurity 12
RM-V042012-02 25 mg

Vandetanib Impurity 12

Sign In for Pricing
View Details
Vandetanib Impurity 12
RM-V042012-03 50 mg

Vandetanib Impurity 12

Sign In for Pricing
View Details
Vandetanib Impurity 12
RM-V042012-04 100 mg

Vandetanib Impurity 12

Sign In for Pricing
View Details
Anti-HOXB2 Antibody
MBS822219-01 0.03 mL

Anti-HOXB2 Antibody

Sign In for Pricing
View Details