Recombinant Rat Parathyroid hormone/parathyroid hormone-related peptide receptor (Pth1r), partial (Active)

Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor (PTH/PTHr receptor) ; Parathyroid hormone 1 receptor (PTH1 receptor) ; Pth1r; Pthr, Pthr1

DADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAANIMESDKGWTPASTSGKPRKEKASGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETREREVFDRLG

Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.

Measured by its binding ability in a functional ELISA.Immobilized Rat Pth1r at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU) . The EC50 is 0.7384-1.203 ng/mL.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

The parathyroid hormone 1 receptor directly binds to the FERM domain of ezrin, an interaction that supports apical receptor localization and signaling in LLC-PK1 cells. Mahon M.J. Mol Endocrinol 23:1691-1701 (2009)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.