Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1E2 Peptide - C-terminal region

AKR1E2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AKR1CL2, AKRDC1, LoopADR, MGC10612

UniProt

Q96JD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1E2 Rabbit Polyclonal Antibody (orb585481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035267

Preservative

Lyophilized powder

AA Sequence

PSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17b-Hydroxyprogesterone
TRC-H950195-1G 1 g

17b-Hydroxyprogesterone

Sign In for Pricing
View Details
UFSP2 Human Gene Knockout Kit (CRISPR)
KN403730 1 Kit

UFSP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Chloro-4-nitrophenyl a-D-mannopyranoside
257645-01 500 mg

2-Chloro-4-nitrophenyl a-D-mannopyranoside

Sign In for Pricing
View Details
2-Chloro-4-nitrophenyl a-D-mannopyranoside
257645-02 1 g

2-Chloro-4-nitrophenyl a-D-mannopyranoside

Sign In for Pricing
View Details
2-Chloro-4-nitrophenyl a-D-mannopyranoside
257645-03 2 g

2-Chloro-4-nitrophenyl a-D-mannopyranoside

Sign In for Pricing
View Details
2-Chloro-4-nitrophenyl a-D-mannopyranoside
257645-04 5 g

2-Chloro-4-nitrophenyl a-D-mannopyranoside

Sign In for Pricing
View Details