Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1E2 Peptide - C-terminal region

AKR1E2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AKR1CL2, AKRDC1, LoopADR, MGC10612

UniProt

Q96JD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1E2 Rabbit Polyclonal Antibody (orb585481) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001035267

Preservative

Lyophilized powder

AA Sequence

PSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Noradrenaline ELISA Kit
ECP7907 1 Each

Noradrenaline ELISA Kit

Sign In for Pricing
View Details
HIVEP2 Antibody
42-246 0.1 mg

HIVEP2 Antibody

Sign In for Pricing
View Details
PIC 485-TRI 100-B7527 AC Signs
223465 Card of 1 Pictogram(s)

PIC 485-TRI 100-B7527 AC Signs

Sign In for Pricing
View Details
EphB4 (Ephrin type-B receptor 4, HTK, MYK1, Tyro11, TYRO11) (FITC)
MBS6258600-01 0.1 mL

EphB4 (Ephrin type-B receptor 4, HTK, MYK1, Tyro11, TYRO11) (FITC)

Sign In for Pricing
View Details
EphB4 (Ephrin type-B receptor 4, HTK, MYK1, Tyro11, TYRO11) (FITC)
MBS6258600-02 5x 0.1 mL

EphB4 (Ephrin type-B receptor 4, HTK, MYK1, Tyro11, TYRO11) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal CPEB1 Antibody [Alexa Fluor 700]
NBP1-76365AF700 0.1 mL

Rabbit Polyclonal CPEB1 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details