Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13B Peptide - middle region

ARL13B Peptide - middle region

Product Specifications

Product Name Alternative

ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8

UniProt

Q3SXY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL13B Rabbit Polyclonal Antibody (orb330697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659433

Preservative

Lyophilized powder

AA Sequence

RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdpk1 (NM_031081) Rat Tagged Lenti ORF Clone
RR206838L4 10 µg

Pdpk1 (NM_031081) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Box of 100 slow qualitative filter, 90 mm
QL04A0090 Box of 100

Box of 100 slow qualitative filter, 90 mm

Sign In for Pricing
View Details
Cln5 3'UTR GFP Stable Cell Line
TU154034 1.0 mL

Cln5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HEATR3 Knockout HGC-27 Polyclonal Cells
ARG29913 1 Million

HEATR3 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
IFIT2 Polyclonal Conjugated Antibody
MBS9439937-01 0.1 mL (Biotin)

IFIT2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
IFIT2 Polyclonal Conjugated Antibody
MBS9439937-02 0.1 mL (AF350)

IFIT2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details