Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13B Peptide - middle region

ARL13B Peptide - middle region

Product Specifications

Product Name Alternative

ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, MGC120611, MGC120612, JBTS8

UniProt

Q3SXY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL13B Rabbit Polyclonal Antibody (orb330697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659433

Preservative

Lyophilized powder

AA Sequence

RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETO siRNA (h)
sc-35342 10 µM

ETO siRNA (h)

Sign In for Pricing
View Details
Khsrp (NM_010613) Mouse Untagged Clone
MC221285 10 µg

Khsrp (NM_010613) Mouse Untagged Clone

Sign In for Pricing
View Details
Dock4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3591207 1.0 µg DNA

Dock4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
SSTR2 Polyclonal Antibody
MBS2565256-01 0.06 mL

SSTR2 Polyclonal Antibody

Sign In for Pricing
View Details
SSTR2 Polyclonal Antibody
MBS2565256-02 0.12 mL

SSTR2 Polyclonal Antibody

Sign In for Pricing
View Details
SSTR2 Polyclonal Antibody
MBS2565256-03 0.2 mL

SSTR2 Polyclonal Antibody

Sign In for Pricing
View Details