Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKA3 Peptide - middle region

SKA3 Peptide - middle region

Product Specifications

Product Name Alternative

MGC4832, RAMA1, C13orf3

UniProt

Q8IX90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKA3 Rabbit Polyclonal Antibody (orb582771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659498

Preservative

Lyophilized powder

AA Sequence

EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy Lansoprazole Sulfide
TRC-H943715-500MG 500 mg

5-Hydroxy Lansoprazole Sulfide

Sign In for Pricing
View Details
turboGFP, AlpHcAbs® Rabbit antibody (Biotin)
HA710091 100 µg

turboGFP, AlpHcAbs® Rabbit antibody (Biotin)

Sign In for Pricing
View Details
MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody
TA367140 100 µL

MRGX1 (MRGPRX1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTP rho (PTPRT) Human Gene Knockout Kit (CRISPR)
KN213847 1 Kit

PTP rho (PTPRT) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Thymus
CS710401 5x 5 µm

Tissue FFPE Sections, Thymus

Sign In for Pricing
View Details
p-Chlorobenzyl Bromide-d6
TRC-C365997-25MG 25 mg

p-Chlorobenzyl Bromide-d6

Sign In for Pricing
View Details