Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKA3 Peptide - middle region

SKA3 Peptide - middle region

Product Specifications

Product Name Alternative

MGC4832, RAMA1, C13orf3

UniProt

Q8IX90

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKA3 Rabbit Polyclonal Antibody (orb582771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_659498

Preservative

Lyophilized powder

AA Sequence

EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human HSP-27 Protein (Sumo Tag)
PDEH100523-01 20 µg

Recombinant Human HSP-27 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human HSP-27 Protein (Sumo Tag)
PDEH100523-02 100 µg

Recombinant Human HSP-27 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human HSP-27 Protein (Sumo Tag)
PDEH100523-03 500 µg

Recombinant Human HSP-27 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human HSP-27 Protein (Sumo Tag)
PDEH100523-04 1 mg

Recombinant Human HSP-27 Protein (Sumo Tag)

Sign In for Pricing
View Details
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA368608 100 µL

glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dabigatran Ethyl Ester Hydrochloride Salt
TRC-D100135-25MG 25 mg

Dabigatran Ethyl Ester Hydrochloride Salt

Sign In for Pricing
View Details