CAMK4 Peptide - N-terminal region
CAMK4 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CaMK-GR, MGC36771, IV, caMK, CaMK IV
UniProt
Q16566
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CAMK4 Rabbit Polyclonal Antibody (orb584994) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001735
Preservative
Lyophilized powder
AA Sequence
GRGATSIVYRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNII
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC700977-500 1x 500 µL
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740669-100 1x 100 µL
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940994-100 1x 100 µL
TNF alpha (J2D10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400009-100 1x 100 µL
MART-1 / Melan-A (M2-7C10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details