Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH5 Peptide - middle region

CDH5 Peptide - middle region

Product Specifications

Product Name Alternative

7B4, CD144, FLJ17376

UniProt

P33151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDH5 Rabbit Polyclonal Antibody (orb584572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001786

Preservative

Lyophilized powder

AA Sequence

SLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZN257 rabbit pAb
E28PN3155 100 µL

ZN257 rabbit pAb

Sign In for Pricing
View Details
DBPA (YBX3) Human shRNA Plasmid Kit (Locus ID 8531)
TL313705 1 Kit

DBPA (YBX3) Human shRNA Plasmid Kit (Locus ID 8531)

Sign In for Pricing
View Details
COL2A1 shRNA Plasmid (h)
sc-35081-SH 20 µg

COL2A1 shRNA Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human ATPAF1 protein, His-tagged
ATPAF1-3625H 25 µg

Recombinant Human ATPAF1 protein, His-tagged

Sign In for Pricing
View Details
Arginase 1 Blocking Peptide
CBP1074-01 1 mg

Arginase 1 Blocking Peptide

Sign In for Pricing
View Details
Arginase 1 Blocking Peptide
CBP1074-02 5 mg

Arginase 1 Blocking Peptide

Sign In for Pricing
View Details