Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH5 Peptide - middle region

CDH5 Peptide - middle region

Product Specifications

Product Name Alternative

7B4, CD144, FLJ17376

UniProt

P33151

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDH5 Rabbit Polyclonal Antibody (orb584572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001786

Preservative

Lyophilized powder

AA Sequence

SLFVEDPDEPQNRMTKYSILRGDYQDAFTIETNPAHNEGIIKPMKPLDYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IKBKG (NF-kappa-B essential modulator) ELISA Kit
EKF57521 96 Tests

Human IKBKG (NF-kappa-B essential modulator) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal GABA-A R delta Antibody (S151-3) [DyLight 650]
NBP1-47616C 0.1 mL

Mouse Monoclonal GABA-A R delta Antibody (S151-3) [DyLight 650]

Sign In for Pricing
View Details
Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit
MBS7246539-01 48 Well

Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit

Sign In for Pricing
View Details
Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit
MBS7246539-02 96 Well

Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit

Sign In for Pricing
View Details
Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit
MBS7246539-03 5x 96 Well

Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit

Sign In for Pricing
View Details
Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit
MBS7246539-04 10x 96 Well

Mouse Colipase-like protein C6orf127 (C6orf127) ELISA Kit

Sign In for Pricing
View Details