Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL4A3 Peptide - middle region

COL4A3 Peptide - middle region

Product Specifications

UniProt

E7ENN2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL4A3 Rabbit Polyclonal Antibody (orb584542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112730

Preservative

Lyophilized powder

AA Sequence

YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFEMP2 Rabbit Polyclonal Antibody
AP01398PU-N 100 µg

EFEMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BARHL2 Human Gene Knockout Kit (CRISPR)
KN417326 1 Kit

BARHL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SIGLEC14 activation kit by CRISPRa
GA119065 1 Kit

Human SIGLEC14 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-01 20 µg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-02 100 µg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human RCAS1 / EBAG9 protein (His tag)
PDEH100958-03 500 µg

Recombinant Human RCAS1 / EBAG9 protein (His tag)

Sign In for Pricing
View Details