COL4A3 Peptide - middle region
COL4A3 Peptide - middle region
Product Specifications
UniProt
E7ENN2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with COL4A3 Rabbit Polyclonal Antibody (orb584542) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112730
Preservative
Lyophilized powder
AA Sequence
YRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP13626PU-N 400 µL
Germinal Center Kinase (MAP4K2) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNCB2045-100 1x 100 µL
HSV1 (Herpes Simplex Virus Type I) ICP8 (HSVI/2045), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![ZNF35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G9]](https://cdn.genprice.uk/products/937/6868c3d7994c49e6dc4000a7/imageurl/ta807059bm.webp)
TA807059BM 100 µL
ZNF35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G9]
Sign In for Pricing
View Details