Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2R1 Peptide - middle region

CYP2R1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC4663

UniProt

Q6VVX0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2R1 Rabbit Polyclonal Antibody (orb580882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078790

Preservative

Lyophilized powder

AA Sequence

FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pinacolone-d9
TRC-P457802-5MG 5 mg

Pinacolone-d9

Sign In for Pricing
View Details
C9orf115 (PTRH1) (NM_001002913) Human Over-expression Lysate
LY424109 100 µg

C9orf115 (PTRH1) (NM_001002913) Human Over-expression Lysate

Sign In for Pricing
View Details
CD3E Mouse Monoclonal Antibody [Clone ID: 4E2]
AM06435SU-N 100 µL

CD3E Mouse Monoclonal Antibody [Clone ID: 4E2]

Sign In for Pricing
View Details
KCNIP4 (N-term) Rabbit Polyclonal Antibody
AP52308PU-N 400 µL

KCNIP4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RS 056812-198 Hydrochloride
TRC-R701023-250MG 250 mg

RS 056812-198 Hydrochloride

Sign In for Pricing
View Details
Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit
E-MSEL-M0009-01 10x 96 Tests

Mini Sample Mouse KIM-1 (Kidney Injury Molecule 1) ELISA Kit

Sign In for Pricing
View Details