Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP2R1 Peptide - middle region

CYP2R1 Peptide - middle region

Product Specifications

Product Name Alternative

MGC4663

UniProt

Q6VVX0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYP2R1 Rabbit Polyclonal Antibody (orb580882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078790

Preservative

Lyophilized powder

AA Sequence

FKQLITNAVSNITNLIIFGERFTYEDTDFQHMIELFSENVELAASASVFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xanthosine Dihydrate
TRC-X742100-1G 1 g

Xanthosine Dihydrate

Sign In for Pricing
View Details
Bid Recombinant Rabbit Monoclonal Antibody [JM11-14]
ET1703-92 100 µL

Bid Recombinant Rabbit Monoclonal Antibody [JM11-14]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS509863 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
GUCY1A1 (NM_000856) Human Over-expression Lysate
LC400301 20 µg

GUCY1A1 (NM_000856) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF404 Human Gene Knockout Kit (CRISPR)
KN415314 1 Kit

ZNF404 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C9orf61 (FAM189A2) (NM_001127608) Human Over-expression Lysate
LY426821 100 µg

C9orf61 (FAM189A2) (NM_001127608) Human Over-expression Lysate

Sign In for Pricing
View Details