Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpf3 Peptide - N-terminal region

Dpf3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810403B03Rik, C78788, CERD4, cer-d4, BAF45C, 6530402L11Rik

UniProt

P58269

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpf3 Rabbit Polyclonal Antibody (orb576896) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_478119

Preservative

Lyophilized powder

AA Sequence

IHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl-9,10-ethanoanthracene-9(10H)-propanoate
TRC-E676560-50MG 50 mg

Ethyl-9,10-ethanoanthracene-9(10H)-propanoate

Sign In for Pricing
View Details
QuicKey Pro Human FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit
E-OSEL-H0030-01 24 Tests

QuicKey Pro Human FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit
E-OSEL-H0030-02 48 Tests

QuicKey Pro Human FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit

Sign In for Pricing
View Details
QuicKey Pro Human FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit
E-OSEL-H0030-03 96 Tests

QuicKey Pro Human FABP1 (Fatty Acid Binding Protein 1, Liver) ELISA Kit

Sign In for Pricing
View Details
Siltuximab Biosimilar - Research Grade
ICH5104-5mg 5 mg

Siltuximab Biosimilar - Research Grade

Sign In for Pricing
View Details
MEAK7 (TLDC1) (NM_020947) Human Over-expression Lysate
LY402813 100 µg

MEAK7 (TLDC1) (NM_020947) Human Over-expression Lysate

Sign In for Pricing
View Details