Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dpf3 Peptide - N-terminal region

Dpf3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810403B03Rik, C78788, CERD4, cer-d4, BAF45C, 6530402L11Rik

UniProt

P58269

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dpf3 Rabbit Polyclonal Antibody (orb576896) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_478119

Preservative

Lyophilized powder

AA Sequence

IHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alpha-Glycerophosphoric Acid-13C3 Bis-cyclohexylammonium Salt
TRC-G598752-1MG 1 mg

Alpha-Glycerophosphoric Acid-13C3 Bis-cyclohexylammonium Salt

Sign In for Pricing
View Details
Human NEK11 activation kit by CRISPRa
GA112682 1 Kit

Human NEK11 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-15373-01 50 μL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-15373-02 100 µL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Recombinant p57 Kip2 Antibody
RC-15373-03 1 mL

Recombinant p57 Kip2 Antibody

Sign In for Pricing
View Details
Notch1 Mouse Gene Knockout Kit (CRISPR)
KN311124RB 1 Kit

Notch1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details