Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FYTTD1 Peptide - middle region

FYTTD1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761B1514, UIF

UniProt

Q96QD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FYTTD1 Rabbit Polyclonal Antibody (orb584687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011537

Preservative

Lyophilized powder

AA Sequence

PSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat I-PTH Protein (Trx Tag)
PDER100113-01 20 µg

Recombinant Rat I-PTH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Rat I-PTH Protein (Trx Tag)
PDER100113-02 100 µg

Recombinant Rat I-PTH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Rat I-PTH Protein (Trx Tag)
PDER100113-03 500 µg

Recombinant Rat I-PTH Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Rat I-PTH Protein (Trx Tag)
PDER100113-04 1 mg

Recombinant Rat I-PTH Protein (Trx Tag)

Sign In for Pricing
View Details
TRIP (TRAIP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]
TA800074AM 100 µL

TRIP (TRAIP) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
Chlonixin
TRC-C587140-500MG 500 mg

Chlonixin

Sign In for Pricing
View Details