Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FYTTD1 Peptide - middle region

FYTTD1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp761B1514, UIF

UniProt

Q96QD9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FYTTD1 Rabbit Polyclonal Antibody (orb584687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011537

Preservative

Lyophilized powder

AA Sequence

PSQLSRKNNIPANFTRSGNKLNHQKDTRQATFLFRRGLKVQAQLNTEQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL
BNC740020-500 1x 500 µL

Cytokeratin 19 (A53-B/A2.26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PNCK Human Gene Knockout Kit (CRISPR)
KN421855 1 Kit

PNCK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cholesterol 5a,6a-epsilonpoxide
TRC-C432528-50MG 50 mg

Cholesterol 5a,6a-epsilonpoxide

Sign In for Pricing
View Details
Human TSP-1 Antibody Pair Set
E-KAB-0223 50 µL & 100 µg

Human TSP-1 Antibody Pair Set

Sign In for Pricing
View Details
ARF5 Rabbit Monoclonal Antibody [Clone ID: 23GB3635]
TA424484S 20 µL

ARF5 Rabbit Monoclonal Antibody [Clone ID: 23GB3635]

Sign In for Pricing
View Details
Lipase (LPS) Activity Assay Kit
E-BC-K786-M-01 48 T (24 samples)

Lipase (LPS) Activity Assay Kit

Sign In for Pricing
View Details