Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL3 Peptide - N-terminal region

ARL3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARFL3

UniProt

P36405

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL3 Rabbit Polyclonal Antibody (orb584409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004302

Preservative

Lyophilized powder

AA Sequence

QRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2AK4 Rabbit Monoclonal Antibody [Clone ID: 23GB5295]
TA424753 100 µL

EIF2AK4 Rabbit Monoclonal Antibody [Clone ID: 23GB5295]

Sign In for Pricing
View Details
Cep95 Rabbit Polyclonal Antibody
TA363498 100 µL

Cep95 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]
TA501171AM 100 µL

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: rectosigmoid
CS713592 5x 5 µm

Tissue FFPE Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
SLC16A9 Human Gene Knockout Kit (CRISPR)
KN416563 1 Kit

SLC16A9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
iFluor™ 647 Conjugated SATB2 Recombinant Rabbit Monoclonal Antibody [JM52-44]
HA720173F 100 µL

iFluor™ 647 Conjugated SATB2 Recombinant Rabbit Monoclonal Antibody [JM52-44]

Sign In for Pricing
View Details