Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6pc Peptide - N-terminal region

G6pc Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW107337, G6Pase, G6pt, Glc-6-Pase

UniProt

P35576

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G6pc Rabbit Polyclonal Antibody (orb579093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032087

Preservative

Lyophilized powder

AA Sequence

DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Biotin Antibody (1D4-C5) [mFluor Violet 610 SE]
NBP3-23510MFV610 0.1 mL

Mouse Monoclonal Biotin Antibody (1D4-C5) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
C5ORF33 (NADK2) Human shRNA Plasmid Kit (Locus ID 133686)
TR307665 1 Kit

C5ORF33 (NADK2) Human shRNA Plasmid Kit (Locus ID 133686)

Sign In for Pricing
View Details
E330021D16Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
18843064 1.0 µg DNA

E330021D16Rik Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Fcf1 (NM_001044235) Rat Tagged ORF Clone
RR201501 10 µg

Fcf1 (NM_001044235) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Mouse IL-1 RI Fc Chimera CF
771-MR-100 100 µg

Recombinant Mouse IL-1 RI Fc Chimera CF

Sign In for Pricing
View Details
ATP2A3 antibody - middle region
MBS3208251-01 0.1 mL

ATP2A3 antibody - middle region

Sign In for Pricing
View Details