Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6pc Peptide - N-terminal region

G6pc Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW107337, G6Pase, G6pt, Glc-6-Pase

UniProt

P35576

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with G6pc Rabbit Polyclonal Antibody (orb579093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032087

Preservative

Lyophilized powder

AA Sequence

DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IGFBP5 antibody
STJ114325 100 µl

Anti-IGFBP5 antibody

Sign In for Pricing
View Details
Bovine Follicle Stimulating Hormone (FSH) ELISA Kit
RD-FSH-b-01 96 Tests

Bovine Follicle Stimulating Hormone (FSH) ELISA Kit

Sign In for Pricing
View Details
Bovine Follicle Stimulating Hormone (FSH) ELISA Kit
RD-FSH-b-02 48 Tests

Bovine Follicle Stimulating Hormone (FSH) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal INSM1 Antibody (INSM1/8122R) [Janelia Fluor 585]
NBP3-20707JF585 0.1 mL

Rabbit Monoclonal INSM1 Antibody (INSM1/8122R) [Janelia Fluor 585]

Sign In for Pricing
View Details
Anti-CALCA Antibody (FITC)
STJ500590 100 µg

Anti-CALCA Antibody (FITC)

Sign In for Pricing
View Details
TNNC1 ELISA Kit (Human) (OKEI00308)
OKEI00308 96 Well

TNNC1 ELISA Kit (Human) (OKEI00308)

Sign In for Pricing
View Details