GABARAP Peptide - N-terminal region
GABARAP Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ25768, MGC120154, MGC120155, MM46, ATG8A
UniProt
O95166
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GABARAP Rabbit Polyclonal Antibody (orb581326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_009209
Preservative
Lyophilized powder
AA Sequence
IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400040-500 1x 500 µL
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470253-100 1x 100 µL
Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details