Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAP Peptide - C-terminal region

GABARAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ25768, MGC120154, MGC120155, MM46, ATG8A

UniProt

O95166

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GABARAP Rabbit Polyclonal Antibody (orb584158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009209

Preservative

Lyophilized powder

AA Sequence

IHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX7 Antibody (Biotin)
KB-8171-01 50 μL

STX7 Antibody (Biotin)

Sign In for Pricing
View Details
STX7 Antibody (Biotin)
KB-8171-02 100 µL

STX7 Antibody (Biotin)

Sign In for Pricing
View Details
STX7 Antibody (Biotin)
KB-8171-03 1 mL

STX7 Antibody (Biotin)

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), 1mg/mL
BNUM0396-50 1x 50 µL

Ep-CAM / CD326 (323/A3), 1mg/mL

Sign In for Pricing
View Details
NUMB (NM_001005744) Human Over-expression Lysate
LC423644 20 µg

NUMB (NM_001005744) Human Over-expression Lysate

Sign In for Pricing
View Details
RhoA (Ab-188) Antibody
8B0568-AAT 50 µg

RhoA (Ab-188) Antibody

Sign In for Pricing
View Details