Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABARAP Peptide - C-terminal region

GABARAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ25768, MGC120154, MGC120155, MM46, ATG8A

UniProt

O95166

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GABARAP Rabbit Polyclonal Antibody (orb584158) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009209

Preservative

Lyophilized powder

AA Sequence

IHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CD14 Protein (His & Fc Tag)
PKSM040907 100 µg

Recombinant Mouse CD14 Protein (His & Fc Tag)

Sign In for Pricing
View Details
Recombinant Inhibin beta A Antibody
RC-5135-01 50 μL

Recombinant Inhibin beta A Antibody

Sign In for Pricing
View Details
Recombinant Inhibin beta A Antibody
RC-5135-02 100 µL

Recombinant Inhibin beta A Antibody

Sign In for Pricing
View Details
Recombinant Inhibin beta A Antibody
RC-5135-03 1 mL

Recombinant Inhibin beta A Antibody

Sign In for Pricing
View Details
TRITC Conjugated Goat Polyclonal Antibody to Hamster IgG
RA-2304-2 2 mL

TRITC Conjugated Goat Polyclonal Antibody to Hamster IgG

Sign In for Pricing
View Details
Recombinant Human CD3d/CD3 delta Protein (His Tag)
PKSH031322-01 50 µg

Recombinant Human CD3d/CD3 delta Protein (His Tag)

Sign In for Pricing
View Details