Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gabarapl2 Peptide - C-terminal region

Gabarapl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gef2, MGC108686, Gabarapl2

UniProt

P60522

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gabarapl2 Rabbit Polyclonal Antibody (orb581669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073197

Preservative

Lyophilized powder

AA Sequence

KRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCRL3 3'UTR Lenti-reporter-Luc Vector
53290081 1.0 µg

BCRL3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rat NKA (Neurokinin A) ELISA Kit
EK240472 96 Well

Rat NKA (Neurokinin A) ELISA Kit

Sign In for Pricing
View Details
Bpnt1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4471002 1.0 µg DNA

Bpnt1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Anti-Phosphomevalonate kinase PMVK Antibody Picoband® Fluoro647 Conjugated
PA1067-Fluoro647 100 µg/Vial

Anti-Phosphomevalonate kinase PMVK Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human Uncharacterized protein KIAA1383, KIAA1383 ELISA KIT
ELI-08056h 96 Tests

Human Uncharacterized protein KIAA1383, KIAA1383 ELISA KIT

Sign In for Pricing
View Details
ATP5J (ATP Synthase-coupling Factor 6, Mitochondrial, ATPase Subunit F6, ATP5A, ATPM) (MaxLight 750) discontinued
123714-ML750 100 µL

ATP5J (ATP Synthase-coupling Factor 6, Mitochondrial, ATPase Subunit F6, ATP5A, ATPM) (MaxLight 750) discontinued

Sign In for Pricing
View Details