Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gabarapl2 Peptide - C-terminal region

Gabarapl2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Gef2, MGC108686, Gabarapl2

UniProt

P60522

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gabarapl2 Rabbit Polyclonal Antibody (orb581669) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073197

Preservative

Lyophilized powder

AA Sequence

KRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-22 Protein (N-His, Human)
P516159 100 µg

IL-22 Protein (N-His, Human)

Sign In for Pricing
View Details
SPPL2A Human Pre-designed siRNA Set A
HY-RS13704 1 Set

SPPL2A Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human AEBP1 Protein Lysate
MBS136965-01 0.02 mg

Human AEBP1 Protein Lysate

Sign In for Pricing
View Details
Human AEBP1 Protein Lysate
MBS136965-02 5x 0.02 mg

Human AEBP1 Protein Lysate

Sign In for Pricing
View Details
Lentiviral mouse Pgls shRNA (UAS) - Lentiviral mouse Pgls shRNA (UAS, GFP) (100)
GTR15209673 1 Vial

Lentiviral mouse Pgls shRNA (UAS) - Lentiviral mouse Pgls shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Sfrp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7223007 1.0 µg DNA

Sfrp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details