Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRR1 Peptide - N-terminal region

GABRR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC163216

UniProt

P24046

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GABRR1 Rabbit Polyclonal Antibody (orb573676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002033

Preservative

Lyophilized powder

AA Sequence

MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin (UBB) Rabbit Polyclonal Antibody
AP06474PU-N 100 µg

Ubiquitin (UBB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human INHB (Inhibin B) ELISA Kit
E-EL-H0313-01 24 Tests

Human INHB (Inhibin B) ELISA Kit

Sign In for Pricing
View Details
Human INHB (Inhibin B) ELISA Kit
E-EL-H0313-02 48 Tests

Human INHB (Inhibin B) ELISA Kit

Sign In for Pricing
View Details
Human INHB (Inhibin B) ELISA Kit
E-EL-H0313-03 96 Tests

Human INHB (Inhibin B) ELISA Kit

Sign In for Pricing
View Details
NFYA Antibody
8C10461-AAT 50 µg

NFYA Antibody

Sign In for Pricing
View Details
Human TSPY2 activation kit by CRISPRa
GA112093 1 Kit

Human TSPY2 activation kit by CRISPRa

Sign In for Pricing
View Details