Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45GIP1 Peptide - middle region

GADD45GIP1 Peptide - middle region

Product Specifications

Product Name Alternative

CKBBP2, CRIF1, MGC4667, MGC4758, PLINP-1, PRG6, Plinp1

UniProt

Q8TAE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GADD45GIP1 Rabbit Polyclonal Antibody (orb585306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443082

Preservative

Lyophilized powder

AA Sequence

SLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6 Rabbit Polyclonal Antibody
TA378723 100 µL

ATP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody [Clone ID: EDU-2]
AM26053BT-N 100 µg

CD4 Mouse Monoclonal Antibody [Clone ID: EDU-2]

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS629202 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
2-N,N-Dibenzyl Serine Benzyl Ester
TRC-D418675-1G 1 g

2-N,N-Dibenzyl Serine Benzyl Ester

Sign In for Pricing
View Details
Indium(III) Chloride
TRC-I533725-5G 5 g

Indium(III) Chloride

Sign In for Pricing
View Details
FIZ1 Human Gene Knockout Kit (CRISPR)
KN424773 1 Kit

FIZ1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details