Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GADD45GIP1 Peptide - middle region

GADD45GIP1 Peptide - middle region

Product Specifications

Product Name Alternative

CKBBP2, CRIF1, MGC4667, MGC4758, PLINP-1, PRG6, Plinp1

UniProt

Q8TAE8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GADD45GIP1 Rabbit Polyclonal Antibody (orb585306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443082

Preservative

Lyophilized powder

AA Sequence

SLRVKQLAEEQKRREREQHIAECMAKMPQMIVNWQQQQRENWEKAQADKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHLH2 (Center) Rabbit Polyclonal Antibody
AP52874PU-N 400 µL

NHLH2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MOG1 (RANGRF) (NM_001177801) Human Over-expression Lysate
LY432588 100 µg

MOG1 (RANGRF) (NM_001177801) Human Over-expression Lysate

Sign In for Pricing
View Details
Ube1L (UBA7) Human Gene Knockout Kit (CRISPR)
KN202883BN 1 Kit

Ube1L (UBA7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-Chloro-7-deaza-9-(2’,3’,5’-tri-O-acetyl-Beta-D-ribofuranoysyl)purine
TRC-C365187-25MG 25 mg

6-Chloro-7-deaza-9-(2’,3’,5’-tri-O-acetyl-Beta-D-ribofuranoysyl)purine

Sign In for Pricing
View Details
Nonafluoro-1-butanesulfonic Acid
TRC-N649325-5G 5 g

Nonafluoro-1-butanesulfonic Acid

Sign In for Pricing
View Details
Recombinant Mouse Motch A/NOTCH1 Protein (His Tag)
PKSM040558 50 µg

Recombinant Mouse Motch A/NOTCH1 Protein (His Tag)

Sign In for Pricing
View Details