Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAL3ST3 Peptide - middle region

GAL3ST3 Peptide - middle region

Product Specifications

Product Name Alternative

GAL3ST-3, GAL3ST2, MGC142112, MGC142114

UniProt

Q96A11

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_149025

Preservative

Lyophilized powder

AA Sequence

AHNTLAYDLGGDNERSPRDDAAYLAGLIRQVEEVFSLVMIAEYFDESLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid Hormone Receptor 1 (PTH1R) (NM_000316) Human Over-expression Lysate
LY400119 100 µg

Parathyroid Hormone Receptor 1 (PTH1R) (NM_000316) Human Over-expression Lysate

Sign In for Pricing
View Details
G-CSF Antibody (Biotin)
KB-7977-01 50 μL

G-CSF Antibody (Biotin)

Sign In for Pricing
View Details
G-CSF Antibody (Biotin)
KB-7977-02 100 µL

G-CSF Antibody (Biotin)

Sign In for Pricing
View Details
G-CSF Antibody (Biotin)
KB-7977-03 1 mL

G-CSF Antibody (Biotin)

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily M, Member 1 (TRPM1) ELISA Kit
RD-TRPM1-Hu-01 96 Tests

Human Transient Receptor Potential Cation Channel Subfamily M, Member 1 (TRPM1) ELISA Kit

Sign In for Pricing
View Details
Human Transient Receptor Potential Cation Channel Subfamily M, Member 1 (TRPM1) ELISA Kit
RD-TRPM1-Hu-02 48 Tests

Human Transient Receptor Potential Cation Channel Subfamily M, Member 1 (TRPM1) ELISA Kit

Sign In for Pricing
View Details