Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAL3ST3 Peptide - middle region

GAL3ST3 Peptide - middle region

Product Specifications

Product Name Alternative

GAL3ST-3, GAL3ST2, MGC142112, MGC142114

UniProt

Q96A11

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_149025

Preservative

Lyophilized powder

AA Sequence

AHNTLAYDLGGDNERSPRDDAAYLAGLIRQVEEVFSLVMIAEYFDESLVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human IL-15 (Interleukin 15) ELISA Kit
E-UNEL-H0387-01 5x 96 Tests

Uncoated Human IL-15 (Interleukin 15) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human IL-15 (Interleukin 15) ELISA Kit
E-UNEL-H0387-02 15x 96 Tests

Uncoated Human IL-15 (Interleukin 15) ELISA Kit

Sign In for Pricing
View Details
ALK Rabbit Polyclonal Antibody
AP21011PU-N 100 µg

ALK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626971 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Slc30a1 Mouse Gene Knockout Kit (CRISPR)
KN516037 1 Kit

Slc30a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PYK2 Antibody
KC-48905-01 50 μL

PYK2 Antibody

Sign In for Pricing
View Details