Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gal3st4 Peptide - C-terminal region

Gal3st4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500031A01Rik

UniProt

Q3V1B8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gal3st4 Rabbit Polyclonal Antibody (orb580889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028588

Preservative

Lyophilized powder

AA Sequence

RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tns2 shRNA Plasmid (h)
sc-96197-SH 20 µg

Tns2 shRNA Plasmid (h)

Sign In for Pricing
View Details
IL-1 beta, human recombinant
4128-1000 1 mg

IL-1 beta, human recombinant

Sign In for Pricing
View Details
SDSL, NT (SDSL, Serine dehydratase-like, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, Serine dehydratase 2) (PE)
MBS6345700-01 0.2 mL

SDSL, NT (SDSL, Serine dehydratase-like, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, Serine dehydratase 2) (PE)

Sign In for Pricing
View Details
SDSL, NT (SDSL, Serine dehydratase-like, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, Serine dehydratase 2) (PE)
MBS6345700-02 5x 0.2 mL

SDSL, NT (SDSL, Serine dehydratase-like, L-serine deaminase, L-serine dehydratase/L-threonine deaminase, L-threonine dehydratase, Serine dehydratase 2) (PE)

Sign In for Pricing
View Details
Mouse Rxrg Pre-designed siRNA Set A
SI112410A 1 Each

Mouse Rxrg Pre-designed siRNA Set A

Sign In for Pricing
View Details
Human AMN1 Pre-designed siRNA Set A
SI000634A 1 Each

Human AMN1 Pre-designed siRNA Set A

Sign In for Pricing
View Details