Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gal3st4 Peptide - C-terminal region

Gal3st4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1500031A01Rik

UniProt

Q3V1B8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gal3st4 Rabbit Polyclonal Antibody (orb580889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001028588

Preservative

Lyophilized powder

AA Sequence

RPLQFGSAKVLGYVLQSGLNQKDKEECERLATPELQYKDKLDAKQFPPTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 25 Hydroxy Vitamin D3, HVD3 ELISA Kit
BG-HUM11249 1 Each

Human 25 Hydroxy Vitamin D3, HVD3 ELISA Kit

Sign In for Pricing
View Details
Anti-GBP1 Antibody Picoband®, FITC Conjugate
A03067-1-FITC 100 µg/Vial

Anti-GBP1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Rat Monoclonal Integrin alpha 2b/CD41 Antibody (MWReg30) [DyLight 488]
NBP1-43415G 0.1 mL

Rat Monoclonal Integrin alpha 2b/CD41 Antibody (MWReg30) [DyLight 488]

Sign In for Pricing
View Details
Mouse tyrosine kinase with immunoglobulin-like and EGF-like domains 2,Tie-2 Elisa Kit
EK731697 96 Well

Mouse tyrosine kinase with immunoglobulin-like and EGF-like domains 2,Tie-2 Elisa Kit

Sign In for Pricing
View Details
Cadherin-23 (H-7) Alexa Fluor® 790
sc-166066 AF790 200 µg/mL

Cadherin-23 (H-7) Alexa Fluor® 790

Sign In for Pricing
View Details
LIN37 Rabbit Polyclonal Antibody (BF350)
orb2481818 100 µL

LIN37 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details