Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALE Peptide - middle region

GALE Peptide - middle region

Product Specifications

Product Name Alternative

SDR1E1

UniProt

Q14376

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALE Rabbit Polyclonal Antibody (orb582318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008217

Preservative

Lyophilized powder

AA Sequence

PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgG1 Polyclonal Antibody
E44H02458 100 µL

IgG1 Polyclonal Antibody

Sign In for Pricing
View Details
2-Boc-6-chloro-3,4-dihydro-1H-isoquinoline-1-carboxylic acid
sc-287839 250 mg

2-Boc-6-chloro-3,4-dihydro-1H-isoquinoline-1-carboxylic acid

Sign In for Pricing
View Details
KBTBD2-set siRNA/shRNA/RNAi Lentivector (Human)
25315091 4x 500 ng

KBTBD2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
ACSS2 Antibody
orb420370 25 µL

ACSS2 Antibody

Sign In for Pricing
View Details
CD86 Recombinant Rabbit mAb, Cy5.5 conjugated
orb3124341 100 µL

CD86 Recombinant Rabbit mAb, Cy5.5 conjugated

Sign In for Pricing
View Details
Bovine HAGH/Hydroxyacylglutathione Hydrolase, Mitochondrial ELISA Kit
MBS2890009-01 48 Well

Bovine HAGH/Hydroxyacylglutathione Hydrolase, Mitochondrial ELISA Kit

Sign In for Pricing
View Details