GALE Peptide - middle region
GALE Peptide - middle region
Product Specifications
Product Name Alternative
SDR1E1
UniProt
Q14376
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GALE Rabbit Polyclonal Antibody (orb582318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001008217
Preservative
Lyophilized powder
AA Sequence
PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1882743-01 100 Tests
PE-conjugated Anti-GFAP (68-377) antibody (DM216); Rabbit mAb
Sign In for Pricing
View Details MBS1882743-02 5x 100 Tests
PE-conjugated Anti-GFAP (68-377) antibody (DM216); Rabbit mAb
Sign In for Pricing
View Details MBS1296844-01 0.02 mg (E-Coli)
Recombinant Symbiobacterium thermophilum Histidinol-phosphate aminotransferase (hisC)
Sign In for Pricing
View Details MBS1296844-02 0.02 mg (Yeast)
Recombinant Symbiobacterium thermophilum Histidinol-phosphate aminotransferase (hisC)
Sign In for Pricing
View Details MBS1296844-03 0.1 mg (E-Coli)
Recombinant Symbiobacterium thermophilum Histidinol-phosphate aminotransferase (hisC)
Sign In for Pricing
View Details MBS1296844-04 0.1 mg (Yeast)
Recombinant Symbiobacterium thermophilum Histidinol-phosphate aminotransferase (hisC)
Sign In for Pricing
View Details