Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK1 Peptide - N-terminal region

GALK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GALK, GK1

UniProt

P51570

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALK1 Rabbit Polyclonal Antibody (orb585166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000145

Preservative

Lyophilized powder

AA Sequence

LELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FKBP25 Recombinant Protein
PROTQ00688-500ug 500 µg

Human FKBP25 Recombinant Protein

Sign In for Pricing
View Details
Mouse 90kDa Heat Shock Protein Alpha A1 (HSP90αA1) ELISA Kit
JL33598-01 48 Tests

Mouse 90kDa Heat Shock Protein Alpha A1 (HSP90αA1) ELISA Kit

Sign In for Pricing
View Details
Mouse 90kDa Heat Shock Protein Alpha A1 (HSP90αA1) ELISA Kit
JL33598-02 96 Tests

Mouse 90kDa Heat Shock Protein Alpha A1 (HSP90αA1) ELISA Kit

Sign In for Pricing
View Details
ATG16L1 Rabbit Polyclonal Antibody
orb331007 100 µL

ATG16L1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Nitroso Bisoprolol
CS-EO-01017 1 Each

N-Nitroso Bisoprolol

Sign In for Pricing
View Details
Human Vascular Cell Adhesion Molecule 1 (VCAM-1) ELISA Kit
MBS9713736-01 48 Tests

Human Vascular Cell Adhesion Molecule 1 (VCAM-1) ELISA Kit

Sign In for Pricing
View Details