Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK1 Peptide - N-terminal region

GALK1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GALK, GK1

UniProt

P51570

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALK1 Rabbit Polyclonal Antibody (orb585166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000145

Preservative

Lyophilized powder

AA Sequence

LELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pantetheinase (VNN1) ELISA kit
CSB-EL025883HU-01 48 Tests

Human Pantetheinase (VNN1) ELISA kit

Sign In for Pricing
View Details
Human Pantetheinase (VNN1) ELISA kit
CSB-EL025883HU-02 96 Tests

Human Pantetheinase (VNN1) ELISA kit

Sign In for Pricing
View Details
Human Pantetheinase (VNN1) ELISA kit
CSB-EL025883HU-03 5x 96 Tests

Human Pantetheinase (VNN1) ELISA kit

Sign In for Pricing
View Details
Human Pantetheinase (VNN1) ELISA kit
CSB-EL025883HU-04 10x 96 Tests

Human Pantetheinase (VNN1) ELISA kit

Sign In for Pricing
View Details
Mouse Nudeotide Binding Digomerzation Domain 3
GTR10444714 96 Well

Mouse Nudeotide Binding Digomerzation Domain 3

Sign In for Pricing
View Details
SAPAP1 Rabbit Polyclonal Antibody
E28PT4212 100 µL

SAPAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details