Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALK1 Peptide - C-terminal region

GALK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GALK, GK1

UniProt

P51570

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALK1 Rabbit Polyclonal Antibody (orb585167) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000145

Preservative

Lyophilized powder

AA Sequence

AVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTP binding protein era homolog (ERAL1) Rabbit Polyclonal Antibody
TA370380 100 µL

GTP binding protein era homolog (ERAL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Homo-L-tyrosine Hydrobromide
TRC-H668000-250MG 250 mg

Homo-L-tyrosine Hydrobromide

Sign In for Pricing
View Details
Pet1 Recombinant Rabbit Monoclonal Antibody [PSH07-77]
HA722893 100 µL

Pet1 Recombinant Rabbit Monoclonal Antibody [PSH07-77]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803Q-01 25 µg

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09803Q-02 100 µg

Elab Fluor® Violet 450 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody
TA378844 100 µL

Myosin Light Chain 2 (MYL2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details