Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt11 Peptide - N-terminal region

Galnt11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Galnt11

UniProt

Q921L8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt11 Rabbit Polyclonal Antibody (orb325499) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955425

Preservative

Lyophilized powder

AA Sequence

LGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E6]
TA813499AM 100 µL

MICB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E6]

Sign In for Pricing
View Details
Human LCN1 activation kit by CRISPRa
GA102667 1 Kit

Human LCN1 activation kit by CRISPRa

Sign In for Pricing
View Details
AOC2 (NM_001158) Human Over-expression Lysate
LC400465 20 µg

AOC2 (NM_001158) Human Over-expression Lysate

Sign In for Pricing
View Details
SARNP Antibody
KC-27827-01 50 μL

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
KC-27827-02 100 µL

SARNP Antibody

Sign In for Pricing
View Details
SARNP Antibody
KC-27827-03 1 mL

SARNP Antibody

Sign In for Pricing
View Details