Galnt11 Peptide - N-terminal region
Galnt11 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Galnt11
UniProt
Q921L8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Galnt11 Rabbit Polyclonal Antibody (orb325499) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_955425
Preservative
Lyophilized powder
AA Sequence
LGMIFNERDQELRDLGYQKHAFNMLISNRLGYHRDVPDTRNAECRRKSYP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741761-100 1x 100 µL
MART-1 / Melan-A / MLANA (Melanoma Marker) (MLANA/1761R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401805-100 1x 100 µL
GP2 (Glycoprotein 2) / ZAP75 (GP2/1805), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941946-100 1x 100 µL
Filaggrin (Keratinocyte Differentiation Marker) (rFLG/1561), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-BC-F093 96 T (40 samples)
Monoamine Oxidase (MAO) Activity Fluorometric Assay Kit
Sign In for Pricing
View Details