Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Galnt3 Peptide - N-terminal region

Galnt3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC124508, Galnt3

UniProt

Q3T1J4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Galnt3 Rabbit Polyclonal Antibody (orb579796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001015032

Preservative

Lyophilized powder

AA Sequence

PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lsm11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3747007 1.0 µg DNA

Lsm11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
IFluor® 660 Anti-human CD20 Antibody *HI20a*
102010G0-AAT 100 Tests

IFluor® 660 Anti-human CD20 Antibody *HI20a*

Sign In for Pricing
View Details
HERG (h8) : 293 Lysate
sc-158613 100 µg - 200 µL

HERG (h8) : 293 Lysate

Sign In for Pricing
View Details
2-Amino-2- (3-chloro-4-methoxyphenyl) ethanol
OR1069115-01 50 mg

2-Amino-2- (3-chloro-4-methoxyphenyl) ethanol

Sign In for Pricing
View Details
2-Amino-2- (3-chloro-4-methoxyphenyl) ethanol
OR1069115-02 100 mg

2-Amino-2- (3-chloro-4-methoxyphenyl) ethanol

Sign In for Pricing
View Details
2-Amino-2- (3-chloro-4-methoxyphenyl) ethanol
OR1069115-03 250 mg

2-Amino-2- (3-chloro-4-methoxyphenyl) ethanol

Sign In for Pricing
View Details