Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALR1 Peptide - C-terminal region

GALR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GALNR, GALNR1

UniProt

P47211

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALR1 Rabbit Polyclonal Antibody (orb331237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001471

Preservative

Lyophilized powder

AA Sequence

CLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Kinesin-like protein KIF3C, KIF3C ELISA KIT
ELI-23752b 96 Tests

Bovine Kinesin-like protein KIF3C, KIF3C ELISA KIT

Sign In for Pricing
View Details
Camk1g Rabbit Polyclonal Antibody
orb13276-01 50 μL

Camk1g Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Camk1g Rabbit Polyclonal Antibody
orb13276-02 100 µL

Camk1g Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Camk1g Rabbit Polyclonal Antibody
orb13276-03 200 µL

Camk1g Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Rangap1 Pre-designed siRNA Set B
SI211604B 1 Each

Rat Rangap1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-CD8 alpha/CD8A Antibody Picoband® (Carrier-free Conjugate)
PB9249-carrier-free 100 µg/Vial

Anti-CD8 alpha/CD8A Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details