Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALR1 Peptide - C-terminal region

GALR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

GALNR, GALNR1

UniProt

P47211

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GALR1 Rabbit Polyclonal Antibody (orb331237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001471

Preservative

Lyophilized powder

AA Sequence

CLAYSNSSVNPIIYAFLSENFRKAYKQVFKCHIRKDSHLSDTKESKSRID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Hydroxypteridine-6-carboxylic acid
TCA16529-01 50 mg

7-Hydroxypteridine-6-carboxylic acid

Sign In for Pricing
View Details
7-Hydroxypteridine-6-carboxylic acid
TCA16529-02 0.5 g

7-Hydroxypteridine-6-carboxylic acid

Sign In for Pricing
View Details
Hltf (NM_001106478) Rat Tagged Lenti ORF Clone
RR214495L3 10 µg

Hltf (NM_001106478) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Taar7e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3154805 3x 1.0 µg

Taar7e sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
H2AFY Recombinant Monoclonal Antibody
RAC08866-01 50 µL

H2AFY Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
H2AFY Recombinant Monoclonal Antibody
RAC08866-02 100 µL

H2AFY Recombinant Monoclonal Antibody

Sign In for Pricing
View Details