Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAN Peptide - middle region

GAN Peptide - middle region

Product Specifications

Product Name Alternative

FLJ38059, GAN1, KLHL16

UniProt

Q9H2C0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GAN Rabbit Polyclonal Antibody (orb326258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071324

Preservative

Lyophilized powder

AA Sequence

IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX5B Rabbit mAb
MBS8602587-01 0.1 mL

COX5B Rabbit mAb

Sign In for Pricing
View Details
COX5B Rabbit mAb
MBS8602587-02 0.1 mL (AF405L)

COX5B Rabbit mAb

Sign In for Pricing
View Details
COX5B Rabbit mAb
MBS8602587-03 0.1 mL (AF405S)

COX5B Rabbit mAb

Sign In for Pricing
View Details
COX5B Rabbit mAb
MBS8602587-04 0.1 mL (AF610)

COX5B Rabbit mAb

Sign In for Pricing
View Details
COX5B Rabbit mAb
MBS8602587-05 0.1 mL (AF635)

COX5B Rabbit mAb

Sign In for Pricing
View Details
COX5B Rabbit mAb
MBS8602587-06 0.1 mL (APC)

COX5B Rabbit mAb

Sign In for Pricing
View Details